PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID EMT01629
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Aegilops
Family MYB_related
Protein Properties Length: 599aa    MW: 67373.4 Da    PI: 6.786
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
EMT01629genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding32.12.6e-10522565447
                      S-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   4 WTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      WT+eE+  ++d+   +G g Wk I++ + +++t+ q+ s+ +ky
         EMT01629 522 WTKEEHWNFLDGLSFYGRGKWKEISKDFVTTKTPVQVSSHAHKY 565
                      ******************************************99 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129410.988515570IPR017930Myb domain
SMARTSM007172.5E-7518568IPR001005SANT/Myb domain
TIGRFAMsTIGR015573.9E-12518568IPR006447Myb domain, plants
SuperFamilySSF466896.1E-14518571IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.603.1E-8521567IPR009057Homeodomain-like
CDDcd001676.29E-6522566No hitNo description
PfamPF002492.7E-7522565IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 599 aa     Download sequence    Send to blast
MDARVSVEEA RSIITRFNNK GSSSDRANHN NHDNNPDTKL RMWYPCETMQ QDAMRVMEKG  60
KGVIAVTEEN KVEALENKMS TYEPVITLST RNDWAQEEHC SLWSAVNERV SVQEPRSIIT  120
WFNNKESSSD GANQNIYNKK PDTKLCMWYP CETMQQDVME KGKGVIAMTE ENKVEALENN  180
MSTHQPVIAP SARNYSTQEE HWFQTTHIST SRGMLTTGTE KIYQGLSALT LLRTLVWVIL  240
SPLSMLLLPL VTHVPPARCS LPRRGCHVRS ERLALALLPD RTTLVKAPVP PSFSPLSPSV  300
VHGVVWRSLH DMHRGTCTIS NVLGSQTMEE ASHTQEGLAV LWDGKDSSYS LIEDKAKGAR  360
AHGLAVEDRM KMGSVGDQAG SCQEVSLDHV LGGPLCLCGK SGTPSCTLTL FCPKVAQFLG  420
LVRSLWYAMN ARVGVEEPGS IITGFNNKES SPVDENISKY NNKPDTELRM QYHCESMQQE  480
GTRVMEESKD VIAMSEDNNV EVLENEMSIR QPVIAPSARI YWTKEEHWNF LDGLSFYGRG  540
KWKEISKDFV TTKTPVQVSS HAHKYFKRLE RKNLRRRYSI NDLGLEIAEP WIMGNSSSA
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
TrEMBLN1QRK40.0N1QRK4_AEGTA; Myb-like protein J
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP84230133
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G10580.23e-18MYB_related family protein